SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003483 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003483
Domain Number 1 Region: 8-486
Classification Level Classification E-value
Superfamily ALDH-like 5.11e-162
Family ALDH-like 0.0000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003483   Gene: ENSTTRG00000003711   Transcript: ENSTTRT00000003710
Sequence length 487
Comment pep:known_by_projection scaffold:turTru1:scaffold_114816:253410:274000:-1 gene:ENSTTRG00000003711 transcript:ENSTTRT00000003710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTRALLMLENFIDGKFLPCSSYLDSYDPSTGEVYCRVPNSGKEEIEAAVEAARAAFPG
WSSRSPQERSQVLQRLADLLEQSLEELAQAESRDQGKTLTLARTMDIPRSVQNFRFFASS
ILHHTSECTQMDHLGCLHYTVRTPVGIAGLISPWNLPLYLLTWKLAPAIAAGNTVIAKPS
ELTSVTAWMMCKLLEKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLEECVPTTVRSSFANQGEICLCTSRIFVQKSIY
SEFLKRFVEATRMWKVGIPSDPSADMGALISKAHLEKVRSYIKKARMEGAQILCGEGVDK
LNLPLRNRAGYFMLPTVITDIKDESCCMKEEIFGPVTCVVPFDSEEEVIQRANSVKYGLA
ATVWSGNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGVGREGAKDSYEFFTEI
KTITIKH
Download sequence
Identical sequences ENSTTRP00000003483 ENSTTRP00000003483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]