SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004829 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004829
Domain Number 1 Region: 179-408
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.43e-57
Family Voltage-gated potassium channels 0.00075
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.12e-31
Family Tetramerization domain of potassium channels 0.000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004829   Gene: ENSTTRG00000005139   Transcript: ENSTTRT00000005121
Sequence length 655
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_939:131830:350462:-1 gene:ENSTTRG00000005139 transcript:ENSTTRT00000005121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY
TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELMGTPEEEHMGKTTSLIESQHHHLL
HCLEKTTXXXXXXXXXXXXXXXXXXXNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHP
GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDG
LRPNCKTSQITTAIISIPTPPALTPEGEGRPPPASPGSNTNIPAMASNVVKVSAL
Download sequence
Identical sequences ENSTTRP00000004829 ENSTTRP00000004829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]