SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005894 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005894
Domain Number 1 Region: 49-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000406
Family V set domains (antibody variable domain-like) 0.026
Further Details:      
 
Domain Number 2 Region: 275-361
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000961
Family I set domains 0.034
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000005894
Domain Number - Region: 172-204
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0667
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005894   Gene: ENSTTRG00000006245   Transcript: ENSTTRT00000006230
Sequence length 414
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1253:41020:42264:1 gene:ENSTTRG00000006245 transcript:ENSTTRT00000006230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLAQATVLLWVLGSLQAFEIVEKENIFQRTPCPAFLMFDNAAYLADMSFELPCHCKPEE
VSSVVWYYQKHLGSGHTKVLTDFDGRVLTEAAQVRVGSDMLVRFSIHMFSLLVFRAQPED
SGLYFCGTRKGDYFYAYDVDIQSSERMVATFEDQGQEPFADEYHGSLRVFTTFWEWTPCD
RCGVRGEQWRIGLCYLQSPGLSPRYRKTLPDVVSCGSRAVPRQLRAKARDHVPELLLRSC
LVPCEEKKKIQEGVMALFSYVAKVGSRPWLPPVPIQFHQQRLGHGLIISCPGARPEHAVA
WDKDQQYLYRTQYLKGVNRSMRVFIDHGNHLHIRFTQLEDRGIYYCWRQGVRIAGLRLGV
TSRGRYPVSFSNPEIRAALVLTLIGYLLITAVFITIHLCRCCCYLFRCYPNFSP
Download sequence
Identical sequences ENSTTRP00000005894 ENSTTRP00000005894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]