SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006224 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006224
Domain Number 1 Region: 534-625
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.32e-41
Family Small-conductance potassium channel 0.00000363
Further Details:      
 
Domain Number 2 Region: 403-575
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.29e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000006224
Domain Number - Region: 33-116
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000246
Family beta-sandwich domain of Sec23/24 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006224   Gene: ENSTTRG00000006578   Transcript: ENSTTRT00000006578
Sequence length 721
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1700:33575:207088:-1 gene:ENSTTRG00000006578 transcript:ENSTTRT00000006578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQPPPPPPPAPAPPAAPQQPPGPPLQPQ
PPQLQQQQQQQPHPLSQLAQLQSQPIHPGLLHSSPTAFRGPPSSNSTVILHPSSRQGSQL
NLNDHLLGHSPTSTATSGPGGGGRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMKPLSR
LSASRRNLIEAEPEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNAAHNHQHAGATA
SSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGLYS
KDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEM
LVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFT
DASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDV
TSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTK
AEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQ
LRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASV
NSLPLLIADTLRQQQRQFLSALTEARGVSVAVGTTHTPLSDSPIGVSSTSFPTPYTSSSS
C
Download sequence
Identical sequences ENSTTRP00000006224 ENSTTRP00000006224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]