SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006515 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006515
Domain Number 1 Region: 79-211
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.92e-17
Family N-acetyl transferase, NAT 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006515   Gene: ENSTTRG00000006891   Transcript: ENSTTRT00000006891
Sequence length 307
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2960:42156:44809:-1 gene:ENSTTRG00000006891 transcript:ENSTTRT00000006891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQELTLSPGPAKLTPTLDPIHQVVLILSTTPALTLDPACQPELTLGSACHPEMTLSPGST
ELTLDPARQPEETPAPNLAELTLEPVHCRPELLDACADLINEQWPRSRASRLHSLGQSSD
AFPLCLMLLSPRPTPEADPIVVGHARLSRVLDRPQSLLVETVVVARALRGRGFGRCLMEG
LEAFAQARGFRRLHLTTHDQLHFYAHLGYQLGEPVQGLVFTSRWLPATLVSAFPRASFPR
PPCRAPSLTAQAAPRAPKGSSLPPPPPLPEPLTTLPPPPGGPPPQSLLETQYQDLRRRPI
FWMEKDI
Download sequence
Identical sequences ENSTTRP00000006515 ENSTTRP00000006515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]