SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008707 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008707
Domain Number 1 Region: 239-313
Classification Level Classification E-value
Superfamily TAFH domain-like 7.46e-20
Family TAFH domain-like 0.0000328
Further Details:      
 
Domain Number 2 Region: 496-543
Classification Level Classification E-value
Superfamily Histone-fold 2.51e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008707   Gene: ENSTTRG00000009139   Transcript: ENSTTRT00000009182
Sequence length 709
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2950:493526:560476:-1 gene:ENSTTRG00000009139 transcript:ENSTTRT00000009182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNKQGALPAGVAKELPSPAPGTPTVVPKGSTSAVTQSLPRTPSATTGGIRATLTPTVLAP
RLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQAQPQTAMAPRP
ATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSTALQRSPGVQPQLVL
GGAAQTPSLGTATAVQTGTPQRTVPGATTTSTAATXXXXXXXXXXXXXXXXXXXXXXXKQ
STETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYVPFKRSLPALRQLTPDSAAF
IQQSQQQPPPASQATTALTAVVLSGSVQRTAGKTAATVTSALQPPVISLAQPTPVGVGKQ
GQPTPLVIQPPPKPGALIRPPQTLTQTPMVALRQPHNRIVLTTPQQIQLNQLQPVPVVKP
AVLPGTKALSTVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATN
SELVGTLTRSCKDETFLLPAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEK
ISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQ
EDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDSPAPGSGVEGSGPGS
AVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSTTRP00000008707 ENSTTRP00000008707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]