SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008748 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008748
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-44
Family G proteins 0.0000221
Further Details:      
 
Domain Number 2 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000785
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008748   Gene: ENSTTRG00000009228   Transcript: ENSTTRT00000009224
Sequence length 281
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3148:261906:290491:1 gene:ENSTTRG00000009228 transcript:ENSTTRT00000009224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRS
YSLATGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences ENSTTRP00000008748 ENSTTRP00000008748 XP_004270414.1.21590 XP_007453678.1.90284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]