SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011554 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011554
Domain Number 1 Region: 691-826,885-951
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.75e-40
Family Hemopexin-like domain 0.00086
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000589
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000157
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011554   Gene: ENSTTRG00000012178   Transcript: ENSTTRT00000012184
Sequence length 951
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_947:106342:127077:1 gene:ENSTTRG00000012178 transcript:ENSTTRT00000012184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKILPIYFLLLLSVFLIQQVSSQDLSSCAGRCGEGYSRDAICNCDYNCQHYMECCPDF
KKVCAVEFSCKGRCFESFSRGRACDCDSECKKYGKCCSDYDSFCEKVHSPASPPPSKSAP
PPPGTTQTIIRTKRPKSSSKKTKKVEETFFITEEHSVSENQSSSSSSSTFRKIKFSKNSA
ANRLKKKPKAKENKKKRTPKTKPTPEPPVIDEAGSGPDNGDFKLTPTPNIPTTQRNKFTT
TPKITIVKPILSKPSIPPNSDTTKETPLTANKETTDETKETSTTNKQTSTTAKEKTTSAK
ETQNAEKTSTKDFAPTSKESTPITTKEPAPTTTKEQAPTTPKELAPTTKESTPITTKEPA
PTTTKVPAPTTTKEQAPTTKESTPINTKEPAPTTTKEQALTTKESTPITTKEPAPTTTKV
PAPTTPKEPASATPKESTPSSPNTPAPTTSEASPSTITMEPPTTPKGPVESTPEFPVEPT
PKTLENSPKEPAVPTTKAPKVTKPEMTTTAKDKATEQDTTDTMASSKITLKATTPAPKVM
TATKKTTEETTSKPEPTTAIPKGTATNAQVTTPKPQKPTAKKLTCTKRPTPYVKTKTPTP
PKMXXXXXXSNPTSLAEAKLHTTTSPNQTPTSEIIEVNPNEDADATEGEKPQMMIPRPPV
LTPIVIPGTDFIGRGPSQGIGINPLFSDETNLCNGKPVDGLTTLRNGTLVAFRGHYFWML
NAFSPPSPPRRITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDIKDAGYPKLIS
KGFGGLNGKIVAALTIAKYKNRPESVYFFKRGGSIQQYTYKQEPTQKCTRRKLAISYPVY
GETTQIRTRRFERAIEPSQTHTIRIHYSPIRVTYQDKGFLHNEVKVSILWRGLPNVVTSA
ISLPNIRKPDGYDYYAFSKDQYYNIDVPTRTARGITTRSGQTLSNVWYNCP
Download sequence
Identical sequences ENSTTRP00000011554 ENSTTRP00000011554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]