SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013260 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013260
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily LEM domain 0.000000000000122
Family LEM domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013260   Gene: ENSTTRG00000013984   Transcript: ENSTTRT00000013983
Sequence length 183
Comment pep:known_by_projection scaffold:turTru1:scaffold_110595:16137:38324:-1 gene:ENSTTRG00000013984 transcript:ENSTTRT00000013983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVKCLSDDELQNELDKFGFSPGPILSSTRKVKEKKLVQLLVSTPCASPEMNGPRELDR
AQDYDDSEELNATIISKGNIIFSSEKNKGPKKRPKAPTSKPKSLEGFCLDSKRSEGRRCA
ARASNVRFKAWNNIRENACCIVNRSAGSRNIETFPAGLKLAVFGIFITVIFVYITVEGKP
LFG
Download sequence
Identical sequences ENSTTRP00000013260 ENSTTRP00000013260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]