SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013305 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013305
Domain Number 1 Region: 1154-1309,1349-1428
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-41
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 2 Region: 129-271,335-404
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-29
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 669-897
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-28
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 1524-1729
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-25
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013305   Gene: ENSTTRG00000014025   Transcript: ENSTTRT00000014029
Sequence length 1957
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3139:44690:120643:-1 gene:ENSTTRG00000014025 transcript:ENSTTRT00000014029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPSGSLETTNFHRFTPESLVEIEKRIAAKQEAKKTKEKSKKQKDQEEKTRPQLDLKAC
NQLPKFYGELPAELVGEPLEDLDPFYSTHRTFMVLNKGRTISRFSATRALWLFSPFNLIR
RTAIKVSVHSWFSLFITITILVNCVGMTQTELPERMEYVFTVIYTFEALIKILARGFCLN
EFTYLRDPWNWLDFSVITLAYVGEAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI
HSVRKLADVTILTIFCLSVFALVGLQLFKGNLKNKCVKNCTVVNETANYSSHEKPDFYTN
KPGTSDPLLCGNGSDSGHCPEGYFCLKTSDNPDFNYTSFDSFAWAFLSLFRLMTQDSWER
LYQQTLRASGKIYMFFFVLVIFLGSFYLVNLILAVVTMAYEEQNQATTDEIEAKEKKFQE
ALQMLRTEQEVLAALGVDTASLHSHNGSPLASKNASVRRHRMKPRVSEGSTDDNKSPQTE
SYNEHRMSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGVTDDVFPGDCQSHRGS
LLLRDASQQGPLPRSPLPQTPSPGLGRGEDGPPTLPTGELAAGAIEVSXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXFEESKQRCPPCLTSLARKYLIWDCCPTWVKLKTL
LFVIVTDPFAELTITLCIVVNTIFMAMEHYGMSPAFEAMLQIGNIVFTVFFTAEMVFKII
AFDPYYYFQKKWNIFDCIIVTVSLIELGAVRKGSLTVLRTFRLLRVFKLAKSWPTLNTLI
KIIGNSVGALGNLTIILAIIVFVFALVGKQLLGDNYRDNRRKISAPNEEWPRWHMHDFFH
SFLIVFRILCGEWIENMWACMEVGQKSICLILFLTVMVLGNLVVLNLFIALLLNSFSTDN
LTAPEDDGEVNNLQVALARIQVLGRRIKKALCSFLNWPFLLPRPKAEPQLVVKLPLSTSK
AENHITADTAAGSPGGLLAPGGPRDDHSDFITNPNIWVSVPIAEGESDLDDLEDDGEEDA
QSTQQEVIPQGQQEQRQQVGRYEDHLPPRSSGSGMSSEDLAPHLGEKLKDEAPAQGPTEG
VDDTNSSEGSTVDCLDLGEILRKIPELADDLDEPDDCVTEGCIRHCSCCKVNSSKFPWAM
GWQVRKTCYVIVEHSWFESFIIFMILLSSGALAFEDFYLDQKPTVKALLEYTDRVFTFIF
VFEMLLKWVAYGFKSYFTNAWCWLDFLIVNISLTSLIAKVLQYSDMASIKALRTLRALRP
LRALSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFQKCINKTSEG
FLLVPWTTVNNMSDCERQNHTGNFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAV
DSREVNMQPKWEDNVYMYLYFIIFIIFGSFFTLNLFVGVIIDNFNQQKKKLGGQDIFMTE
EQKKYYNAMKKLGSKKPQKPIPRPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXGECVMKMFALRHYYFTNGWNVFDLIVVVLSIGSLVFS
AILTSLGNLFSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLV
MFIYSIFGMANFAYVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPY
CDPNLPNSNGTRGDCGNPIVGILFFTTYIIISFLIVVNMYIAVILENFNVATKESTEPLS
EDDFDMFYETWEKFDPEATQFITFSALSDFADTLSGPLRIPKPNGNILIQMDLPLVPGDK
IHCLDILFTFTKNVLGESGELDSLKANMEEKFMATNLSKASYEPIATTLRWKQEDISATV
IQKAYRSYVLHRSMTIANPPPVPRAEEEAVPLPDEGFVAFVADENCVLPDKSETASATSF
PPSYDSVTRGLSDQVNLSTSSSIQNEGEAATKEATGP
Download sequence
Identical sequences ENSTTRP00000013305 ENSTTRP00000013305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]