SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014856 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014856
Domain Number 1 Region: 255-516
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.36e-37
Family Voltage-gated potassium channels 0.0047
Further Details:      
 
Domain Number 2 Region: 659-709
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000419
Family cAMP-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014856   Gene: ENSTTRG00000015682   Transcript: ENSTTRT00000015680
Sequence length 1127
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_214:303870:346455:-1 gene:ENSTTRG00000015682 transcript:ENSTTRT00000015680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLPPSMRKRLYSLPQQVGAKAWIMDEEEDAEEEGAGGRQDPSRRSIRLRPLPSPSPSA
AAGGTEPRGAALGAADSEGSTRGAGKSSTNGDCRRFRGSLASLGSRGGGGARSGGGTVHG
HLHDSAEERRLFAEGDAPGEDRTXXXXXXXXXXXXXXXXXXXXXXLPQQPPQPVPASCEQ
PSVDTAIKVEGGAAAGDQILPEAEVRLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAVE
REQERVKSVGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVV
SDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKMKYLKSWFVVDFISSIPVDYIFLIVET
RIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNL
IGMMLLLCHWDGCLQFLVPMLQDPDDXXXXXXXXXNNSWGRQYSYALFKAMSHMLCIGYG
RQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIC
LLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILL
HKVQHDLNSGVFNYQENEIIQQIVQHDREMAHCAHRVQAAASATPTPTPVIWTPLIQAPL
QAAAATTSVAIALTHHPRLPAAIFRPPPGPGLGGLGAGQTPRHLKRLQSLIPSALGSASP
ASSPSQVDTPSSSSFHIQQLAGFSAPAGLSPLLPSSSSSPPPGGGSSSSAPTPSAAAAVA
AATAGFGHFHKALGGSLSSSDSPLLTPLQPGARSPQANQPAPPLPGARGGLGLAEHFLPP
PASARSPSSSPGQLGQPPGELSPGLTAGPPSTPETPPRQPERLSLAAGASGGASPVAFTP
RGGLSPPGHSPGPPRTFPSAPPRASGSHGSLLLPPASSPPPPQVPQRRGTPPLTPGRLTQ
DLKLISASQPALPQDGAQTLRRASPHSSGESVAAFPLFPRGGGGSGG
Download sequence
Identical sequences ENSTTRP00000014856 ENSTTRP00000014856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]