SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016088 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016088
Domain Number 1 Region: 91-261,308-379
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.28e-36
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 865-1020,1060-1136
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.08e-29
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 1185-1347,1415-1439
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-25
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 530-635
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000051
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016088   Gene: ENSTTRG00000016971   Transcript: ENSTTRT00000016971
Sequence length 1973
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_70:40601:66081:-1 gene:ENSTTRG00000016971 transcript:ENSTTRT00000016971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASEGKDTTPEPSPANGTGPGPEWGLCPGPPASGGEIGGASSLGTPKRRTQHSKHKTVA
VASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDSN
TANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLLE
QGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHIA
LLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDVEAEEDPSPCASSGSGRACTLNQTECRG
RWAGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSF
FVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLRGYLDXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXPQLAKLTNRRRGRLHWFSHSTHSTHSTSSHASLPASDTGSMATP
GDEEEEEGALASCTRCLNKIMRTSVCRCLRRANRGLRARCRRAVKSNACYWAVLLLVFLN
TLTIASEHHGQPIWLTQIQEYANKVLLCLFTVEMLLKLYGLGPSVYVSSFFNRFDCFVVC
GGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXILNVFLAIAVDNLASGDAGTDKDKGREKNTEETPQ
ENGALVPGGENEEEEGAKNEGAGMEEEEEEEEEEEEEEEGGAGHVELLQEVVPKEKVVPI
PEGSAFFCLSQTNPLRKACHTLIHHHVFTNLILVFIILSSVSLAAEDPIRAHSFRNHILG
YFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISFGIHSSAISVV
KILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGK
FYSCTDEAKHTPQECKGSFLVYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFTVSTF
EGWPALLYKAIDANAENKGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITFRAQGE
QEYQDCELDKNQRQCVEYALKAQPLRRYIPKNPNQYRVWATVNSAAFEYLMFLLILLNTV
ALAMQHYEQTAPFNYVMDILNMVFTGLFTVEMVLKIIAFKPKHYFTDAWNTFDALIVVGS
VVDIAVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQ
ALPYVALLIAMIFFIYAVIGMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCATGEAW
QEIMLASLPGSRCDPESDFGPGEEFSCGSNFAIAYFISFFMLCAFLIINLFVAVIMDNFD
YLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVAC
KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGLLGAEAPPSTSSALQAGLRSLQ
DLGPEMRQALTCDTDEEEEEEGQEGEEEEDEKEPETYKAPVGSQPPSRRSSVISVSLPAW
DKPPDSLSLGPSDDDGGAPNSRQSSVPQAGSHAHRRSSGVLIFTIPEEGSSQSKATKGQE
KQDEREEVPSQLSYLDEQAGTPPRPILLPPHRPQRYVDDHQAPRRRLLPPTPAGRKPSFT
IQCLRRQGSCEDLPIPGTYHRGRNSGPSRAQGSWATPPQRGRLLYAPLLLVEEGAAGDGY
LGKSSSPLRTFTCLHVPGTHSDPTYGKRGSADSLVEAVLISEGLGLFARDPRFVALAKRE
IADACRLTLDEMDSAASDLLAQGTSSLYSDEESILSRLDEEDLGDEMACVHAL
Download sequence
Identical sequences ENSTTRP00000016088 ENSTTRP00000016088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]