SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209554138|ref|YP_002284874.1| from Ureaplasma urealyticum serovar 10 str. ATCC 33699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209554138|ref|YP_002284874.1|
Domain Number 1 Region: 6-237
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.78e-65
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000129
Further Details:      
 
Domain Number 2 Region: 246-344
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 8.24e-23
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|209554138|ref|YP_002284874.1|
Sequence length 360
Comment DNA polymerase family protein [Ureaplasma urealyticum serovar 10 str. ATCC 33699]
Sequence
MQSSGQKIIMHLDIDAFYATVSELLHPEYKNFPIAVGSLNSRTGIISSPNYLARSYGVKS
AMPIFLAKELCPNLIILPCEHDIYQTYSNHFFQIVNKYCNKVEITSIDECFIDATNSIKK
YHNNVRLLAAKIQNEVKNKLNLSISVGISFNKTIAKMATELNKPFGISIIDENKITNLIH
ELDISKIPFIGEIKSQELYAINIFKIKELIASNNKQKASLVLGSMYQNLVNDLKGLNEIK
TIEDDIYKSISHSKTFNEDLNDFYEISNELNELISNVVNRLKKHNLMTNNISINIKYPNF
QTKVKQKRLDYYTDDYQTIFLAIKNLFKKVYKDELVRLIGVSLNKLVPKESVKKQLFLFD
Download sequence
Identical sequences B1RYE2 B5ZBT4
gi|209554138|ref|YP_002284874.1| WP_004027185.1.47960 WP_004027185.1.48701 WP_004027185.1.53767 565575.UUR10_0483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]