SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209554192|ref|YP_002284681.1| from Ureaplasma urealyticum serovar 10 str. ATCC 33699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209554192|ref|YP_002284681.1|
Domain Number 1 Region: 10-85,177-357
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.19e-53
Family Bacterial dinuclear zinc exopeptidases 0.0000573
Further Details:      
 
Domain Number 2 Region: 75-185
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.27e-24
Family Aminopeptidase/glucanase lid domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|209554192|ref|YP_002284681.1|
Sequence length 363
Comment endo-1,4-beta-glucanase [Ureaplasma urealyticum serovar 10 str. ATCC 33699]
Sequence
MSKFSEKEIRQKAIEYMEIYGMSRHEERVATKLKTSLKDVGVSYERDNLGSIIFKKTNSN
KGPKILIATHMDEVGFVVQQILDNGQLLLSMVGGVWPNIVIGSVAKVYVDEQRQYTGVFG
HTSIHILEPEARSKAVPVKELFVDCGFSSKQQALDLGVEIGTEVYMEGPSLNFHDENYIV
GKAVDNRVSVAVLDLLVHSLKDKVIPNQTYFAATVQEEVGLRGAKTVVSKVKPDIGIVID
TTTSHDTYKCPEGDTKLNDGVCIRMKDGGTLVNPALVKYFEALAKKHNIPLYKYVARGGG
TDAEELQYGPDGGVLTIGLSIPQRYLHAPIGVATVKDMKAAFDLVREFLEVFDENEFEKV
KFK
Download sequence
Identical sequences B1RXZ2 B2DAY1 B2NEP8 B2NH14 B3XSW5 B3XVG3 B5BN86 B5ZB91 B9ZXV8 C0AFM0
gi|209554192|ref|YP_002284681.1| WP_004026122.1.11034 WP_004026122.1.11042 WP_004026122.1.11293 WP_004026122.1.14788 WP_004026122.1.47624 WP_004026122.1.47960 WP_004026122.1.48701 WP_004026122.1.53767 WP_004026122.1.54081 WP_004026122.1.55625 WP_004026122.1.78419 WP_004026122.1.92358 WP_004026122.1.95657 WP_004026122.1.96248 565575.UUR10_0278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]