SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209554467|ref|YP_002284603.1| from Ureaplasma urealyticum serovar 10 str. ATCC 33699

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209554467|ref|YP_002284603.1|
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily DhaL-like 2.88e-41
Family DhaL-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|209554467|ref|YP_002284603.1|
Sequence length 564
Comment DAK2 domain protein [Ureaplasma urealyticum serovar 10 str. ATCC 33699]
Sequence
MKTIKLDLFQKMLYAGAKILEIECQYINDLNVFPVPDGDTGSNMKTTTAGAIVAIKEAEI
TNFSQLAKIFSRGLLMNARGNSGVILSQIFRGFMDALNNDSDEVNIDQLKQAFNSAKDKA
YASVSTPIEGTILTVIRVVKERINEYDNFDSVEDLFAFATKEAEIILEKTPEMLPSLKEA
NVVDSGGYGLVSFLKGMYQSLTNIFDEKLIIKNEEENIKSKTKPLDLEVVHKEKEEGFGY
CSEIILSLKKKIVPNSANKSFFELEKYKAELAKIGDSIVAIQDEDLVKVHLHTLTPYKFL
QISQKYGEFDKVKIDNMTNQFYENLERKGLSTKKENKATLNMEQKIIATVPSEKFKKMFI
EEHGIENVIVTETEGAPSIQRFVDEINTTNAAQVFIVTDDSNIVLAAEQASKIAAENNVL
VSVIGAYNVFEALLAISHFEQQNDYRTNFKTMNKIVKKARSGVISTSIKDVKYPHITVNK
DDYIGIINKKIVASKKTAYEALLTTIEMLIESLKKPEICYIYYGINASQTDVHQIEKYIS
EKYGIICDLRYTGQSLYHYYIGIQ
Download sequence
Identical sequences B1RX23 B2D9K3 B2NEH1 B2NGQ4 B3XT45 B3XUR9 B5BMU9 B5ZB13 B9ZXN0
WP_004025888.1.11034 WP_004025888.1.11293 WP_004025888.1.14788 WP_004025888.1.47960 WP_004025888.1.48701 WP_004025888.1.53767 WP_004025888.1.54081 WP_004025888.1.55625 WP_004025888.1.78419 WP_004025888.1.92358 WP_004025888.1.95657 WP_004025888.1.96248 gi|209554467|ref|YP_002284603.1| 565575.UUR10_0198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]