SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gb|TGVEG_107770 from Toxoplasma gondii VEG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|TGVEG_107770
Domain Number 1 Region: 1-184,1361-1470
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.43e-28
Family ABC transporter ATPase domain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 976-1062,1123-1227,1352-1474
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-19
Family ABC transporter ATPase domain-like 0.0048
Further Details:      
 
Domain Number 3 Region: 595-651,697-801
Classification Level Classification E-value
Superfamily Smc hinge domain 0.00000000523
Family Smc hinge domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gb|TGVEG_107770
Sequence length 1523
Comment | organism=Toxoplasma_gondii_VEG | product=structural maintenance of chromosome domain-containing protein | location=TGVEG_chrIX:6074274-6094996(-) | length=1523
Sequence
MHIKEVTIRGFRTYRHSTTIHFSPGYNCIVGANGSGKSNVLLAIAFALGEGGQSSTERRM
LLHEGMNERVSDGSVQVVLANEDRRLCMYDDDEVQIRRVFSATTDDSFVQGKRISKSGLQ
QLLECAGFARGRSGTASSIASTSTAYFIQQGRIVQIALQSGAERLALLQTVAGGASFDAK
TREIETLMRVGATEAGRIESQVKEIGEKLAEMSSERRELNECVHLEEEKEKIDYVLAELA
WREAASYLETHARACAEQTTRIESLEERLEGAESLREDLEKQRELLKTQVSRQTALRDEA
ANVQTELRAEEEKLRLEANLWEKKEEAEIQGDAERDEKLRDLKEKLRIAEMKLANELRPS
LDETQKKYQELQQRFQQAQQQLTALQCKRGILAARSHMQRGSSSRKSTSKEVSGGAKEAP
RCSDADVQREIKQAEHLRKEETEMIKTLTAQIEALTRERAELEADREASQHGQAKAAEEL
RETEAAQRDLSKAFEEALEELRVHQAQLGELLQEYTVAKDALASAEDRFWQQLRTDVREG
LHAAIDFARSRGWSTRTREKLEKQTSSTAPERPRNSSGDDTPSPEKQCEKTQMPAGMLLD
FIHVAPEYRRAVEAVGAHALTAFLVPDARAAEDLLSYLKSRKTRACGSSVLGRRSREEEA
KRDERSGCVQEGKPNVSITVVPLKEVAELQREKEELSRNKARRTRIRTLTEEGKCMPLVE
CVDVQLSYSASSSADGQQEGDSGVELVSAYIRSVLGRAMLVPSLAQTDDGLVSSLHEKGL
DCVTVDGDVGFASGVVRGGGVMPSFLSSHADQQSRDLWAQPACGKLQAYRNLRQRQEQLD
RLGQQIEEKRKRLAEVESRHDAFIEKEQLLSETRARCQANLEEAVASRQQIDGRLRATMD
LLAAVEEGARQATQRVHGIKTLIQNLRRENVSPDTAGLSLSEEKDATRLPGEIRAMEKEM
ALLKDEAEQREREVREASSEVDFHLRKQVERLEREEARGRRSEAREKRQEVEERLAAVNR
RMLQEEEVSRKCERRLRVLEEELEEKEGELDLAEKQRQGIVAQIEDALKTLQISKRAAES
AQRAKDDAETLLAATGAAAAAAPDVSQLRLLSSRELAVKLGAVKKKLEGYSHVNRRAVEQ
FSNLQDDFMDLQQRESRQKGTQEAIREQLKILVRRKKKAVLASFDRVNEEFQKIFATLVP
GGRAEMILQHSLLPDNAHGCFDDDAVQCAKGRDEKTRHRSNSLDAKARGQASRDKRFEME
HEEAKAGGEEGKEGDDGGASLIGVDIRAAFSDAGALTASTRGGADRANHQLALLNSTGGE
NRKDKDGRTHGMNQLSEAVAQACRFWEAKEELLSFSPLCCCLSRELLSGGQKSLVSLALL
LALQRVSCCLSSSPSAEFSAGEEVKETPGGVLLLDEVDAALDENHRRAAAQALAQTASRR
ISQVILTTFRPELLSPADALFHISQENRVSYVEEIDLRAAMDILQEQQGEEIALHEEASR
RMERDSDARLRGLPLTFPPLPAH
Download sequence
Identical sequences gi|211968057|gb|EEB03253.1| gi|237842191|ref|XP_002370393.1| gb|TGVEG_107770 gb|TGME49_106310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]