SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389858422|ref|YP_006360664.1| from Chlamydia trachomatis F/SW4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389858422|ref|YP_006360664.1|
Domain Number 1 Region: 353-372,447-653
Classification Level Classification E-value
Superfamily HAD-like 1.88e-52
Family Meta-cation ATPase, catalytic domain P 0.0016
Further Details:      
 
Domain Number 2 Region: 156-250
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.11e-19
Family Calcium ATPase, transduction domain A 0.0057
Further Details:      
 
Domain Number 3 Region: 101-153,251-339
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000000366
Family Calcium ATPase, transmembrane domain M 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389858422|ref|YP_006360664.1|
Sequence length 659
Comment cation transporting ATPase [Chlamydia trachomatis F/SW4]
Sequence
MSPQLFSSPFSRELLSNFFESGMAEENSPLLSQKNRRLSQNLTLKSAYISLALYLGSLLS
HWIGYQALSSLLLILTFFLAGTPALIKSFEDILDRTVNIDILMTSAAFGSIFIGGALEGA
LLLVLFAISESLGAMVSGKAKSTLASLKHLAPTVAWVVQQDGSLQKVLVQNVKVGEIIRV
KSGEVVPLDGKIIQGASSINLMHLTGEKIPKSCGIGDTIPAGAHNLEGSFDLQVLRIGAE
STIAHIINLVVQAQSSKPKLQQRLDRYSSTYALTIFAISACIAIGGSLFTTLPFLGPDSA
FYRALAFLIAASPCALIIAIPIAYLSAINACAKHGVLLKGGVVLDRLVSCNSVVMDKTGT
LTTGDLTCSGCEDFGPESPLFYSCVLAMEQSSSHPIAQAIVNYLTEKQVQSLPATQCTTI
PGEGVSGEFNGEQAFVGRVSTALRYVPEEYREQLRERAQQAQERGDTCSIACLGKRVSLF
YFRDVPRHDAADIVSYLKKNGYPVCMLTGDHRISAENTARLLGIDEVFYDLTPDNKLSKI
QELAKSRQIMMIGDGINDAPALAQATVGIAMGEAGSATAIEAADVVLLNQGLSSLPWLID
KAKKTRRIVSQNLALALAIILFISGPASMGVIPLWLAVILHEGSTVIVGLNALRLLKNT
Download sequence
Identical sequences A0A0E9CF72
gi|386263083|ref|YP_005816362.1| gi|471328901|ref|YP_007540426.1| gi|478456587|ref|YP_007726970.1| gi|478461993|ref|YP_007736943.1| gi|478428863|ref|YP_007541303.1| WP_009872881.1.100466 WP_009872881.1.11717 WP_009872881.1.13766 WP_009872881.1.13837 WP_009872881.1.1409 WP_009872881.1.14786 WP_009872881.1.15381 WP_009872881.1.19304 WP_009872881.1.20022 WP_009872881.1.25246 WP_009872881.1.29171 WP_009872881.1.31373 WP_009872881.1.32156 WP_009872881.1.32856 WP_009872881.1.35043 WP_009872881.1.36244 WP_009872881.1.36518 WP_009872881.1.3661 WP_009872881.1.37417 WP_009872881.1.37673 WP_009872881.1.37956 WP_009872881.1.38813 WP_009872881.1.39258 WP_009872881.1.40272 WP_009872881.1.4187 WP_009872881.1.44223 WP_009872881.1.48551 WP_009872881.1.4939 WP_009872881.1.51530 WP_009872881.1.57520 WP_009872881.1.57533 WP_009872881.1.62510 WP_009872881.1.66489 WP_009872881.1.69519 WP_009872881.1.69991 WP_009872881.1.74635 WP_009872881.1.77153 WP_009872881.1.78375 WP_009872881.1.85256 WP_009872881.1.87298 WP_009872881.1.87666 WP_009872881.1.88177 WP_009872881.1.88937 WP_009872881.1.9107 WP_009872881.1.96955 gi|527321373|ref|YP_008347572.1| gi|478472802|ref|YP_007733369.1| gi|385242120|ref|YP_005809960.1| gi|389858422|ref|YP_006360664.1| gi|389860174|ref|YP_006362414.1| gi|478473703|ref|YP_007735151.1| gi|389859298|ref|YP_006361539.1| gi|478474607|ref|YP_007730683.1| gi|385245730|ref|YP_005814553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]