SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|Tc00.1047053503467.9 from Trypanosoma cruzi strain CL Brener

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|Tc00.1047053503467.9
Domain Number 1 Region: 48-343
Classification Level Classification E-value
Superfamily ApbE-like 6.02e-55
Family ApbE-like 0.0017
Further Details:      
 
Domain Number 2 Region: 380-588
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.19e-29
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|Tc00.1047053503467.9
Sequence length 588
Comment | organism=Trypanosoma_cruzi_CL_Brener_Esmeraldo-like | product=NADH-dependent fumarate reductase, putative | location=TcChr38-S:368882-370645(+) | length=588
Sequence
MADGRSSASVVAVDPEKAARERDEAARALLRDSPLQTHLQYMTNGLELTVPFTLKVVAEA
VAFSRAKEVADEVLRSAWHLADTVLNNFNPNSEISMIGRLPVGQKHTMSATLKSVITCCQ
HVFNSSRGVFDPATGPIIEALRAKVAEKASVSDEQMEKLFRVCNFPSSFSVDLEMGTIAR
KHEDARFDLGGVSKGYIVDYVVERLNAAGIVDVYFEWGGDCRASGTNARRTPWMVGIIRP
PSMEQLRNPPKDPSYIRVLPLNDEALCTSGDYENLTEGSNKKLYTSIFDWKKKDLLEPVE
SELAQVSIKCYSAMYADALATASLIKRDIKKVRQMLEEWRHVRNRVTNYVTYTRQGERVA
RMFEIATDNAEIRKKRIAGSLPARVIVVGGGLAGLSAAIEATACGAQVILLEKEPRVGGN
SAKATSGINGWGTRAQAEQDVYDSGKYFERDTHKSGLGGSTDPGLVRTLSVKSGDAISWL
SSLGVPLTVLSQLGGHSRKRTHRAPDKADGTPVPIGFTIMQTLEQHVRTKLADRVTIMEN
TTVTSLLSKSRVRHDGAKQVRVYGVEVLQDEGVASRILADAVILATGG
Download sequence
Identical sequences Q4CQU6
gi|71403387|ref|XP_804499.1| psu|Tc00.1047053503467.9 XP_804499.1.87722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]