SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|Tc00.1047053508535.10 from Trypanosoma cruzi strain CL Brener

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|Tc00.1047053508535.10
Domain Number 1 Region: 136-413
Classification Level Classification E-value
Superfamily ApbE-like 6.28e-53
Family ApbE-like 0.0012
Further Details:      
 
Domain Number 2 Region: 452-728,894-951
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.84e-47
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000722
Further Details:      
 
Domain Number 3 Region: 1065-1205
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.27e-29
Family Reductases 0.0016
Further Details:      
 
Domain Number 4 Region: 717-881
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.09e-29
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00052
Further Details:      
 
Domain Number 5 Region: 950-1058
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000000000733
Family Ferredoxin reductase FAD-binding domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|Tc00.1047053508535.10
Sequence length 1215
Comment | organism=Trypanosoma_cruzi_CL_Brener_Esmeraldo-like | product=NADH-dependent fumarate reductase, putative | location=TcChr38-S:216447-220094(+) | length=1215
Sequence
MFSTMRILLRTATIGVATGTMAMTTTLVSGAHLAAVRWSSSSTSDNSPALLSQRSFFSGG
ADGRSSASIVVVDAELAAKERDRIAREMLSQNMPSPHAEERLVVTMRGLEHTVPYTLRIV
LNGPNEAKNGEVIAGKVLKEAFEVVDQHLNHYNPESEVSAINQLPLGAKHTMSQHMRRVM
ECCVRVYASSGACFDPATGPLVEFLRSVMKDEKSDAESTLTEEEVERFCLPQSFDVNMTD
GTIARKHEGAKLDLGGVNKGYTVDRVVEKLNAAGMRDVMFEWGGDCRATGVNYQHQPWAI
AIVRPPPVEVVEQHAKEGLDEKKEASQLLRLMYLDDEALCTSGDYENVMYSPKYGVRSNI
FDWKKRSLLEPVESELAQVSIKCYSAMYADALATASLIKRDISKVRHMLEEWRHSRNRVT
NYVTYTRQGERVARMFEIATENAEIRKNRIAGSLPARVIVVGCGLAGLSAAIEATACGAQ
VILLEKEPKVGGNSAKATSGINGWGTRAQALDDIQDNCNIFERDTHKSGLGGSTVPSLVR
TLSVKSGDAISWLSSLGVPLTVLSQLGGHSRKRTHRAPDKADGTPVPIGFTIMRTLEQHV
RTKLADRVTIMESTVVTSLLNEIKGTPDGGREVRVTGVTYKKSDEKEAGSMKLTADAVIL
ATGGFSNDHMSQSLIGEFAPELSGFPTTNGPWATGDGVKLARRLGATLVDMEKVQLHPTG
LIDPKDPANPTKYLGPEALRGSGGVLLNKKGERFVNELELRSVVSNAIIEQGDEYPYSGG
SKFAFCVLNDAAVKLFGVNLLNFYANTLGVFKRVDDLQGLAMLIGCDVLTLQNTLETYES
SSIVTSACPFTGKVVYPCVVGPQGPFYVAFVTPSIHYTMGGCLISPSAEIQREHYSLNLL
ENQRPILGLFGAGEVTGGVHGGNRLGGNSLLECVVFGRIAGDRAATILQKQVYALSKDKW
TSVVVRESRSGERFGTGSRVLRFNLPGALQRSGLYLGQFIAIRGEWDGQQLIGYYSPITL
PDERGVISILARGDKGTLKEWISAMRPGDSVEIKSCGGILIERNPAKKQFLFHGHVIRQF
GLIAGGSGVAPMLQIIRAALERPYVDTTESIRLVYTAEEYEELTYRELLHHYSKENPDKF
SVEFSLNNPPEGWTGGVGFVDRPSLRKTLQPPSNDLLIAICGPPAMQRAMKNDLLAMGYN
PALVHTVDDDMQAAL
Download sequence
Identical sequences Q4CYX1
gi|71410008|ref|XP_807320.1| psu|Tc00.1047053508535.10 XP_807320.1.87722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]