SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|Tc00.1047053510215.10 from Trypanosoma cruzi strain CL Brener

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|Tc00.1047053510215.10
Domain Number 1 Region: 48-343
Classification Level Classification E-value
Superfamily ApbE-like 1.44e-54
Family ApbE-like 0.0014
Further Details:      
 
Domain Number 2 Region: 377-652,805-880
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.15e-50
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 641-805
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.79e-33
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00023
Further Details:      
 
Domain Number 4 Region: 1002-1128
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.11e-28
Family Reductases 0.0022
Further Details:      
 
Domain Number 5 Region: 884-982
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000000000000176
Family Ferredoxin reductase FAD-binding domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|Tc00.1047053510215.10
Sequence length 1142
Comment | organism=Trypanosoma_cruzi_CL_Brener_Esmeraldo-like | product=NADH-dependent fumarate reductase, putative | location=TcChr38-S:372567-375995(+) | length=1142
Sequence
MADGRSSASVVAVDPEKAARERDEAARALLRDSPLQTHLQYMTNGLELTVPFTLKVVAEA
VAFSRAKEVADEVLRSAWHLADTVLNNFNPNSEISMIGRLPVGQKHTMSATLKSVITCCQ
HVFNSSRGVFDPATGPIIEALRAKVAEKASVSDEQMEKLFRVCNFSSSFIVDLEMGTIAR
KHEDARFDLGGVSKGYIVDYVVERLNAAGIVDVYFEWGGDCRASGTNARRTPWMVGIIRP
PSLEQLRNPPKDPSYIRVLPLNDEALCTSGDYENLTEGSNKKLYTSIFDWKKRSLLEPVE
SELAQVSIRCYSAMYADALATASLIKRDIKKVRQMLEDWRHVRNRVTNYVTYTRQGERVA
RMFEIATDNAEIRKKRIAGSLPARVIVVGGGLAGLSAAIEATACGAQVILLEKEPKVGGN
SAKATSGINGWGTRAQAEQDVYDSGKYFERDTHKSGLGGSTDPGLVRTLSVKSGDAISWL
SSLGVPLTVLSQLGGHSRKRTHRAPDKADGTPVPIGFTIMQTLEQHVRTKLADRVTIMEN
TTVTSLLSKSRVRHDGAKQVRVYGVEVLQDEGVVSRILADAVILATGGFSNDKTPNSLLQ
EFAPQLSGFPTTNGPWATGDGVKLARELGVKLVDMDKVQLHPTGLIDPKDPANPTKYLGP
EALRGSGGVLLNKKGERFVNELDLRSVVSNAIIEQGDEYPDAGGSKFAFCVLNDAAVKLF
GVNSHGFYWKRLGLFVKADTVEKLAALIGCPVENVRNTLGDYEQLSKENRQCPKTRKVVY
PCVVGPQGPFYVAFVTPSIHYTMGGCLISPSAEMQLEENTTSPFGHRRPIFGLFGAGEVT
GGVHGGNRLGGNSLLECVVFGRIAGDRAATILQKKPVPLSFKTWTTVILREVREGGMYGT
GSRVLRFNLPGALQRSGLQLGQFIAIRGEWDGQQLIGYYSPITLPDDLGVIGILARSDKG
TLKEWISALEPGDAVEMKGCGGLVIERRFSERYLYFSGHALKKLCLIAGGTGVAPMLQII
RAALKKPFLENIESIRLIYAAEDVSELTYRELLEHHQRDSKGKFRSIFVLNRPPPIWTDG
VGFIDKKLLSSSVQPPAKDLLVAICGPPIMQRVVKTCLKSLGYDMQLVRTVDEVETQNSS
KM
Download sequence
Identical sequences Q4CMU8
XP_803046.1.87722 gi|71400421|ref|XP_803046.1| psu|Tc00.1047053510215.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]