SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|508606233|ref|YP_006992055.2| from Carnobacterium maltaromaticum LMA28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|508606233|ref|YP_006992055.2|
Domain Number 1 Region: 1-258
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.27e-65
Family Phosphate binding protein-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|508606233|ref|YP_006992055.2|
Sequence length 259
Comment bacterial extracellular solute-binding s, 3 family protein [Carnobacterium maltaromaticum LMA28]
Sequence
MKKKLILVSLLCLAFVIGGCKSETKANTNEKNKIIVGLDDTFVPMGYRDKAGKIVGLDVD
LAKEFGKRANVDIEFQPIDWAMKETELNSGNIDLIWNGYAMNPERSEKVNFSTPYLEIGQ
AIIVLKDSPIETKNDLAGKTVAAQQSSSAVTILSQDAPELLKSFKGGEMVTYASNNDVFN
DLDSKRSEAIIVGETYGRYTIKQKGEDNYRILKENFGVENIAVGVRKADKELLKQVNQAL
KEMEEDGTKEKIVNKWFSE
Download sequence
Identical sequences A0A0R2IJL5 A0A0R2J9P2 K8E3G6
gi|508606233|ref|YP_006992055.2| WP_010050447.1.1647 WP_010050447.1.23088 WP_010050447.1.23174 WP_010050447.1.47092 WP_010050447.1.4825 WP_010050447.1.85729 WP_010050447.1.92980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]