SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479317564|ref|YP_007857615.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479317564|ref|YP_007857615.1|
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily DhaL-like 5.62e-54
Family DhaL-like 0.000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479317564|ref|YP_007857615.1|
Sequence length 205
Comment phosphoenolpyruvate-dihydroxyacetone phosphotransferase ADP-binding subunit DhaL [Streptomyces sp. PAMC26508]
Sequence
MLDTDFFRRWMAVTAAAVDREADRLTELDAAIGDADHGSNMRRGFAAVNDVLEKEDPRTP
GTVLTLAGRHLISTVGGASGPLYGTLLRRTGKALGDATEVTTDQLADALGAGVAAVTQLG
GAQAGDKTMLDALLPAVEVLGTSFEAARDAALAGALETVPMRARKGRASYLGERSIGHQD
PGAASSALLVGALVEAAGSSDGSAG
Download sequence
Identical sequences A0A285D8F7 E8VZN8 M9TL64
gi|479317564|ref|YP_007857615.1| WP_014157937.1.77427 WP_014157937.1.81163 WP_014157937.1.83303 WP_014157937.1.8887 WP_014157937.1.8937 WP_014157937.1.98132 gi|357415116|ref|YP_004926852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]