SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479318113|ref|YP_007858164.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479318113|ref|YP_007858164.1|
Domain Number 1 Region: 51-320,380-418
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.73e-84
Family Type II chitinase 0.000005
Further Details:      
 
Domain Number 2 Region: 322-381
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000504
Family Chitinase insertion domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479318113|ref|YP_007858164.1|
Sequence length 421
Comment chitinase [Streptomyces sp. PAMC26508]
Sequence
MTGLHRPRARLRALAATFCTAALGAALLGVAGTSSAGAAPTASAPAAAGATPTAAGDKVV
GYFTNWGVYQRDYHVKNIETSGSADKLTHINYAFGNVQGGKCTIGDSYADYEKAYTADQS
VDGVADTWDQELRGNFNQLRKLKKLHPDLKVIWSFGGWSWSGGFAEAAKNPAAFAESCHS
LVEDPRWADVFDGIDIDWEYPNACGLTCDTSGRDAYGDLLSALRSKFGTDSLITSAITAD
GSDGGKIDAVDYAGAAQYLDWYNPMTYDFFGAFAAQGPTAPHSPLTSYPGIPTEGFNSDA
AISKLKGLGIPAEKLLLGIGFYGRGWTGVTQSEPGGTATGAAPGTYEAGIEDYKVLKDSC
PATGTVAGTAYAHCGTDWWSYDTPATIATKMDYKNQQGLGGTFFWELSGDTANGELIKAI
N
Download sequence
Identical sequences M9TRR8
WP_015576332.1.83303 WP_015576332.1.8887 WP_015576332.1.98132 gi|479318113|ref|YP_007858164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]