SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479318903|ref|YP_007858954.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479318903|ref|YP_007858954.1|
Domain Number 1 Region: 15-271
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.39e-70
Family Protein kinases, catalytic subunit 0.00000355
Further Details:      
 
Domain Number 2 Region: 579-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000275
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|479318903|ref|YP_007858954.1|
Domain Number - Region: 512-573
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000602
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 
Domain Number - Region: 444-505
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0497
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479318903|ref|YP_007858954.1|
Sequence length 640
Comment putative serine/threonine-protein kinase PknL [Streptomyces sp. PAMC26508]
Sequence
MDTTLQDPLVGQLLDGRYRVDARIAVGGMATVYRAVDTRLDRVLALKVMHPALATDAAFV
ERFIREAKSVARLAHPNVVGVFDQGAQGAYVYLAMEYVAGCTLRDVLRERGALQPRAALD
ILEPVLAALGAAHLAGFVHRDMKPENVLIGDDGRVKVADFGLVRAVGTATDTTGSLLGTV
SYLAPEQIEQGTADTRSDVYACGVVLYEMLTGGKPHGGDTAAQVIYQHLNEDVPAPSDAV
PGLAAGLDELVAAATARNPDLRPSDAVALLAASRVIREALTEEQLDAMPPQALAETHDAA
EDRTSVIPRVIPAGQGTAHHTSRLEMPRTALPEPGLGRRVPLAFRGRRGVLTAVVTVLLV
LGAGAGVWYINSGQFTRVPALLGKTQSAAEERLADEGLDLKGVERAYSDTVRRGTVISSD
PGSGERIRGNDAVKLVISRGPETVKVPDVEGLALADARRELKKWGLAPGMATREFSEEID
RGKVIRTDPRAGTERHTDSAVALVVSKGSPVDVPDVTGLSVDDATAALDEAGLKAEVLPE
RVNSAEAQGEIARQTPGSGAEAAEGDTVELTVSKGPRMLQVPDVTGKDVDEARSTLEDAG
FEVKVDRPFLSFSDTVGSQSVEGGEKAAEGSTITIRTKAL
Download sequence
Identical sequences M9TUA6
gi|479318903|ref|YP_007858954.1| WP_015576841.1.83303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]