SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479318935|ref|YP_007858986.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479318935|ref|YP_007858986.1|
Domain Number 1 Region: 19-296
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.02e-62
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479318935|ref|YP_007858986.1|
Sequence length 541
Comment ubiquinol-cytochrome c reductase cytochrome B subunit [Streptomyces sp. PAMC26508]
Sequence
MSTATETQRKAPAGERVADWADGRLGIYGLAKANMRKIFPDHWSFMLGEICLYSFIIIIL
TGVYLTLFFHPSMNEVVYHGSYEPMQGIRMSEAYASTLDISFDVRGGLLVRQIHHWAAVI
FLAGMFVHMFRVFFTGAYRKPREINWLFGFLLFVLGMFTGFTGYSLPDDLLSGTGVRFTQ
GAILSMPIVGTYISMFLFGGEFPGTDIIARFYSIHILLLPGIMLGLVVGHLILVFFHKHT
QFAGPGKTNKNVVGMPLLPVYMAKAGGFFFLVFGFISVIAAIATINPIWALGPYRPDQVS
TGAQPDWYMGFAEGFVRVMPGWEINLWGHTLVLGVLIPLVLFGVVLAALALYPFIESWIT
GDKREHHILDRPRNAPTRTGLGVAWVTIYFVMLIGGGNDIWATHFHMSLNAISWFVRIAF
FVGPVLAFVVTRRICLGLQRRDKEKVLHGRESGTIKRLPHGEFVEIHEPLSPEQLHTLTA
HEQYKPIEIGPTVDENGVERKPSALQKLRARLSKSYYGENNQIAKPTAEEYKEITSGHGH
H
Download sequence
Identical sequences A0A285D1D2 E8WGE3 M9TQJ0
WP_014156687.1.34797 WP_014156687.1.77427 WP_014156687.1.77540 WP_014156687.1.81163 WP_014156687.1.83303 WP_014156687.1.8887 WP_014156687.1.8937 WP_014156687.1.98132 gi|479318935|ref|YP_007858986.1| gi|357413857|ref|YP_004925593.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]