SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479319338|ref|YP_007859389.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479319338|ref|YP_007859389.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily L21p-like 8.11e-31
Family Ribosomal protein L21p 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479319338|ref|YP_007859389.1|
Sequence length 106
Comment LSU ribosomal protein L21p [Streptomyces sp. PAMC26508]
Sequence
MYAIVRSGGRQHKVAVGDIVEVDKISTAKVGDTVELSTLLVVDGDAVTSDPWVLDGIKVQ
AEIVDHHKGAKIDILRYKNKTGYRRRQGHRQQYTAIKVTGIPAAAK
Download sequence
Identical sequences A0A0N0HPU0 M9TVI7
gi|479319338|ref|YP_007859389.1| WP_015577124.1.34797 WP_015577124.1.4682 WP_015577124.1.49592 WP_015577124.1.52350 WP_015577124.1.76928 WP_015577124.1.77427 WP_015577124.1.77540 WP_015577124.1.81163 WP_015577124.1.83303 WP_015577124.1.8887 WP_015577124.1.8937 WP_015577124.1.98132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]