SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479319609|ref|YP_007859660.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479319609|ref|YP_007859660.1|
Domain Number 1 Region: 126-284
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.49e-20
Family Multidrug-binding domain of transcription activator BmrR 0.066
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000116
Family AraC type transcriptional activator 0.0061
Further Details:      
 
Domain Number 3 Region: 55-105
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000233
Family AraC type transcriptional activator 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479319609|ref|YP_007859660.1|
Sequence length 288
Comment transcriptional regulator [Streptomyces sp. PAMC26508]
Sequence
MLERLNQAMEHIESHLDQPLDVAGLARIATTSEYHFRRMFSALAGLPLSEYVRRRRLTVA
GAEVLAGERTLLDIATRYGYGSGEAFARAFRAVHGVGPGEARRTGAALRSQQRMSFRLIV
EGTSSMRYRIVDKADFRVVGRKARVPLVHEGANPAIADFIRGIGPDVMRRVAALGDQEPA
GIVGVSDQLDPSRAEGTELDYYHGVVTGAEVPEDMDALDVPAGRWAVFEHSGPFPQSLQY
LWRDVFTQWFPSNPYVSRPGPEILSVRLSEEGTQADAELWIPVERSTA
Download sequence
Identical sequences E8W6T7 M9TS11
WP_014156056.1.34797 WP_014156056.1.77427 WP_014156056.1.83303 gi|479319609|ref|YP_007859660.1| gi|357413223|ref|YP_004924959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]