SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479321041|ref|YP_007861092.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479321041|ref|YP_007861092.1|
Domain Number 1 Region: 28-180
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.84e-21
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479321041|ref|YP_007861092.1|
Sequence length 182
Comment transcriptional regulator [Streptomyces sp. PAMC26508]
Sequence
MTAAAARLTQVEARLRSIESEGHMPENDVQIKRVPAVRVAEVTSTAPGYQPQDISPVVGP
LYEKLFPLLATAGVRPTGPGIARYEDGPDGDGSVVVHAGVTVDAPAGPLGDTGVTVVELP
AFEAATIVHRGSMDHVLATEQILARWIEDHGRRPAGYSREVSLECPEDREMWVTELQLPL
VG
Download sequence
Identical sequences M9TTQ7
gi|479321041|ref|YP_007861092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]