SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479323028|ref|YP_007863079.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|479323028|ref|YP_007863079.1|
Domain Number - Region: 126-192
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000719
Family PriA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479323028|ref|YP_007863079.1|
Sequence length 336
Comment ATP-dependent DNA ligase [Streptomyces sp. PAMC26508]
Sequence
MELDVDGRAVRLSNPDKVYFPEKGYTKKDVADYFQAVGPGILRALRERPTTLQRFVDGVE
GDFFYQKRAPKNLPDWTPTARIEFPSGRHADEMCPTELGAVLWAANLGTLTFHPWPVRRA
DTDHPDELRIDLDPQPGTDYADAVRAAHELRAVLDDHGLRGWPKTSGGRGIHVFVPLVPE
WTFTQVRRSAIAVGRELERRMPDRVTTAWWKEERGERIFVDYNQTARDRTIASAYSVRPF
PHAPVSAPLRWEEIDDAEPRDFDLRTMPARYAEAGDLHADMDDHAFRLDGLLELARRDEH
EHELGDLPYPPEYPKMPGEPKRVQPSRARRDDGDPA
Download sequence
Identical sequences A0A285DFX8 E8WAH3 M9U686
WP_014152833.1.77427 WP_014152833.1.77540 WP_014152833.1.81163 WP_014152833.1.83303 WP_014152833.1.8887 WP_014152833.1.8937 WP_014152833.1.98132 gi|479323028|ref|YP_007863079.1| gi|357409939|ref|YP_004921675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]