SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479323221|ref|YP_007863272.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479323221|ref|YP_007863272.1|
Domain Number 1 Region: 2-367
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.64e-114
Family FMN-linked oxidoreductases 0.0000000017
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.65e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000126
Further Details:      
 
Domain Number 3 Region: 461-519,555-649
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.42e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479323221|ref|YP_007863272.1|
Sequence length 671
Comment 2,4-dienoyl-CoA reductase [NADPH] [Streptomyces sp. PAMC26508]
Sequence
MSPYPTLLSPLDLGFTTLPNRVLMGSMHIGLEEVEHGFERMAAFYAARARGGVGLMVTGG
IAPSERACSFPGGARMTTEAEAEQHREVTAAVHAAGGRIAMQILHFGRYAHHPDLVAPSA
LKAPISGFTPHALTDDEVEETVEDFARAAELARSAGYDGVEIMGSEGYLINEFIVAATNH
REDRWGGSYENRIRFPVEIVRRVRERVGPDFILIYRLSMLDLVPGGSTLEEVVQLAREVE
AAGATIINTGIGWHEARIPTIATSVPRGAFTWVTERVRGAVSVPLVTSNRINTPELAEEV
LASGRADMVSMARPFLADPDFVAKAAEGRADAINTCIGCNQACLDHIFSLQITSCLVNPR
ACHETELVLAPTRLRKRVAVVGAGPAGLACAVTASERGHAVTLFDAADEIGGQLNVARRV
PGKEEFDETLRYFRTRLAEEGVELRLGARAGSADLDGFDEVVLATGVEPRTPAIPGVGHP
SVVSYLDVLRDGAEVGDRVAVVGAGGIGFDVAEFLTDGGDGASLDPEVFFRQWGVDTGYA
DRGGLRAPERPKPGRTVHLIQRKATKVGAGLGKTTGWIHRTELRHRGVTMIAGASYDLID
DEGLHLTVDGEQHLLPVDTVVLCAGQEPRRELYEELRAAGRPVHLIGGADVAAELDAKRA
IRQGTELAAEL
Download sequence
Identical sequences M9TZT0
gi|479323221|ref|YP_007863272.1| WP_015579767.1.83303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]