SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479323338|ref|YP_007863389.1| from Streptomyces sp. PAMC26508

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479323338|ref|YP_007863389.1|
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily YaeB-like 1.27e-37
Family YaeB-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479323338|ref|YP_007863389.1|
Sequence length 161
Comment hypothetical protein F750_6480 [Streptomyces sp. PAMC26508]
Sequence
MPSYEVSSIATVVGGHTQVLDDYQGGVRSIIRLNDEYPLETLQGIEEFSHLTVTWRFHRA
RPEDVQLHARSPRGDARWPATGTFVHRNHRRPNQLAISFPRLLGADGRDLHVTDLDAVDG
TPVLDVAPYFQQMGPRGPIRQPAWPGEMLAPTYWSDASERP
Download sequence
Identical sequences M9U750
WP_015579874.1.83303 gi|479323338|ref|YP_007863389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]