SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000001147 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000001147
Domain Number 1 Region: 6-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 307-348
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000324
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000001147
Domain Number - Region: 93-123
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0254
Family BphP N-terminal domain-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000001147   Gene: ENSVPAG00000001242   Transcript: ENSVPAT00000001242
Sequence length 759
Comment pep:novel genescaffold:vicPac1:GeneScaffold_2718:244536:321647:1 gene:ENSVPAG00000001242 transcript:ENSVPAT00000001242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVATGGSILYVSDSITPLLGHL
PSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFNAYNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTPSVVXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXDKGSSLDPPQTIRALYMDTSGLNTSHSPSASSRSSHKSSH
TAMSEPASNPSKLRAEASTTALPRSAQELPVPGLSQAATMPXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXEAQRQLQQRPGPGPQPQLAASPQLTGQIASAQVTSQHLLRES
SVISTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAQSQAVFQNPDVHTTSSS
ASTPVLLMRQAVLHPTFPTSQPSPLKPAQAQQQPPHFLQ
Download sequence
Identical sequences ENSVPAP00000001147 ENSVPAP00000001147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]