SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000002215 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000002215
Domain Number 1 Region: 243-344
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.11e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 97-204
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.93e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 16-72
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000093
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000002215   Gene: ENSVPAG00000002395   Transcript: ENSVPAT00000002395
Sequence length 824
Comment pep:novel genescaffold:vicPac1:GeneScaffold_86:836283:867521:1 gene:ENSVPAG00000002395 transcript:ENSVPAT00000002395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAGGANDKKNRISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASV
MRLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKY
MGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRG
RTMNIKSATWKVLHCTGHIHVYDTNSNQSQCGYKKPPMTCLVLICEPIPHPSNIEIPLDS
KTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQ
VTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTEC
VLKPVESSDMKMTQLFTKVETEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTE
ADDQQLEEVPLYNDVMLPSSNEKLQNINLAMSPLPSSETPKPLRSSADPALNQEVALKLE
PNPESLELSFTMPQIQDQPASPSDGSTRQSSPEPNSPSEYCFDVDSDMVNEFKLELVEKL
FAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSTSPQSASTVTVF
QPTQMQEPPVTTTSTTATTDELKTVTKDGMEDIKILIAFPSPPHVPKETACATTSTYSDT
GSRTSSPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTTPEEELNPKILALQNAQRKRKI
EHDGSLFQAVGIGTLLQQPDDRATTTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRL
LGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences ENSVPAP00000002215 ENSVPAP00000002215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]