SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007797 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007797
Domain Number 1 Region: 218-381,414-476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.33e-38
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 481-663
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-36
Family cAMP-binding domain 0.00093
Further Details:      
 
Domain Number 3 Region: 39-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-21
Family Flavin-binding PAS domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007797   Gene: ENSVPAG00000008382   Transcript: ENSVPAT00000008382
Sequence length 1101
Comment pep:novel genescaffold:vicPac1:GeneScaffold_3145:2505:377877:1 gene:ENSVPAG00000008382 transcript:ENSVPAT00000008382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEV
MQKSCSCKFLFGVETNEQLMLQIEKSLEEKTEFKGEIMFYKKNGSPFWCLLDIVPIKNEK
GDVVLFLASFKDITDTKVKITPEDKKEDKAKGRSRAGTHFDSARRRSRAVLYHISGHLQR
REKNKLNINNNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVP
YNVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVT
TWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLM
SMFALLAHWMACIWYVIGKMEREDNTLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRW
SLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITM
HLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLK
DSMVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHK
FVEDIQHDLTYNLREGHESDVISRLSNKSTVSQXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQL
TDVPNHGKRNEKNLKLQLSTLSNAGPPDLSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTSLTQEGSQLGKDMRTVMQLLEHILS
PQQPSRLCSLHTTSVCPSRDSFQTRTTWSAHQPCLHLQAGGAAYSQTQLCRGNVTSDIWS
VDPSSVGSSPRRTGAPERNPADTELFYSPAHHQVVQEGHLQFLRCISPQSDTTLTPLQSI
SATLSSSVCSSSETSLHLVLPSRSEEGSLGQGAVSSFSLENLPGSWERGRRASVSPDPLE
NFPLEVVTSTAEAKDKKAINV
Download sequence
Identical sequences ENSVPAP00000007797 ENSVPAP00000007797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]