SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009538 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009538
Domain Number 1 Region: 495-681
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-42
Family cAMP-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 367-392,431-527
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-23
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 3 Region: 26-122
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-17
Family Flavin-binding PAS domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009538   Gene: ENSVPAG00000010253   Transcript: ENSVPAT00000010253
Sequence length 810
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1156:878839:1289638:-1 gene:ENSVPAG00000010253 transcript:ENSVPAT00000010253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGE
LTDKDTIEKVRKTFENYEMNSFGNLMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDI
TAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHKHSRLAEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXLQVCVFGLAAHWMVCIWHLIGDYDIFDEDTKTIRNNSWLYQLAMDIGTPYQFN
GSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYAT
IFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTE
KVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGE
SVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCANVRALTYCDLHVIK
RDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPLILPP
DHPVRRLFQRFRQQKEARLAAERGGRDPDDLDVEKGSILTEHSNHGLVKASVVTVRESPA
TPVAFPAAAASAGLDQARLQAPEAEGPKAG
Download sequence
Identical sequences ENSVPAP00000009538 ENSVPAP00000009538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]