SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009879 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009879
Domain Number 1 Region: 645-767
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.35e-32
Family PDEase 0.00024
Further Details:      
 
Domain Number 2 Region: 424-519
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.51e-23
Family PDEase 0.0014
Further Details:      
 
Domain Number 3 Region: 218-262
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000089
Family Flavin-binding PAS domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009879   Gene: ENSVPAG00000010603   Transcript: ENSVPAT00000010612
Sequence length 771
Comment pep:novel genescaffold:vicPac1:GeneScaffold_910:115301:265413:1 gene:ENSVPAG00000010603 transcript:ENSVPAT00000010612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSSAEVRIGPMRLTQDPIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGDCEEASVLPLLHAG
FNRRFMENNSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRADLLDTINCIKKGKEWQGVYYARRKSGDS
IQQHVKITPVIGQGGKIRHFVSLKKLCCTTDSNKQIHKIHRDSGDNSQTESLSFRYKNRR
KESIDVKSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEA
LDRVLEILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHL
AMPITINDVPPSIAQLLDNEESWEFNIFELESVTHKRPLVYLGLKIFSRFGVCEFLHCSE
TTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEGSDCERNSIGKNFPENQILIKR
MMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRNTCSIPKSQI
SFIDYFITDMFDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPTDS
Download sequence
Identical sequences ENSVPAP00000009879 ENSVPAP00000009879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]