SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011317 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011317
Domain Number 1 Region: 358-457
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.03e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00082
Further Details:      
 
Domain Number 2 Region: 95-157
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000034
Family HLH, helix-loop-helix DNA-binding domain 0.0033
Further Details:      
 
Domain Number 3 Region: 179-233,261-276
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000251
Family N-terminal PAS domain of Pas kinase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011317   Gene: ENSVPAG00000012169   Transcript: ENSVPAT00000012169
Sequence length 622
Comment pep:novel genescaffold:vicPac1:GeneScaffold_1143:1045325:1091305:1 gene:ENSVPAG00000012169 transcript:ENSVPAT00000012169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVLIQENQCVASMVSGHQSPWTKPTAVGSFNPHVTEFPRKRKGSDSDPSQGIMKEKVVEK
LSQNPFTYLLSTGVEISASRGSRMEDGEQQVEMKSFREAHSQTEKRRREKMNHLIEKLSA
MIPQCNPVTRKLDKLTVLRMAVQHLRSLNGMANSYAGNNRRPSFIQDNELRHLILKTAEG
FLFVVGCERGKILFVSKSVSKTLNYDQADLTGQSLFDFLHPKDVAKVKEQLSSSDISPRE
MLIDAKTGLQVHSNFHTARSRVYSGSRRSFFCRIKSCKISVKEEYDCLPNSKKKDHRKFY
TIHCTGYLRNWPPNTAGMEEERENKKDRSNSTCLVALGRLRPCIGPQNSGEIKVKPTEFI
TRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSNLTDKHKLQSKEKIFTDS
YKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLEHSETGEASLHLCSSQSSEGS
SRQSCSSEPGMCTGTVLGAGSIGTDIADELLGVQRLQSSSSLDDSSPTDLLKETHTTDSK
NMSSKELITLSPSEIGELGATKQNQSAVAPHSQEPLLGEGAPLDFDALCDHDDTAMAAFM
NYLEAEGGLGDPGDFSDIHWTL
Download sequence
Identical sequences ENSVPAP00000011317 ENSVPAP00000011317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]