SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004630 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004630
Domain Number 1 Region: 77-147
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.000000000288
Family Translation initiation factor IF3, N-terminal domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000004630
Domain Number - Region: 154-199
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 0.029
Family Translation initiation factor IF3, C-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004630   Gene: ENSVPAG00000004994   Transcript: ENSVPAT00000004994
Sequence length 233
Comment pep:novel scaffold:vicPac1:scaffold_5817:49377:53134:1 gene:ENSVPAG00000004994 transcript:ENSVPAT00000004994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALFLKRLTLQITKTEFHHIGXFGKYVVQKMASAQPSPIASAPRPSCLTHAKAFSMEDI
RDEQRKKKKDDTAFSNIGRKISERIIHVLDEQGNDLGHMHRATVIRLMDERDLRLVRRDP
GAEPPKYQLLTGAQIHQERLRLRELEKAKPRTGPTLTKELTEEIFNQILQTMPGRATFSS
KPQPIRGGKAVMCVLRPLSRKEETVSAAAQGAPRGDPLNRETGNDGESGGPHQ
Download sequence
Identical sequences ENSVPAP00000004630 ENSVPAP00000004630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]