SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009252 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009252
Domain Number 1 Region: 327-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000137
Family EGF-type module 0.045
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000009252
Domain Number - Region: 56-102
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 0.0157
Family Peptidyl-tRNA hydrolase-like 0.011
Further Details:      
 
Domain Number - Region: 298-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0255
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009252   Gene: ENSVPAG00000009943   Transcript: ENSVPAT00000009942
Sequence length 542
Comment pep:novel genescaffold:vicPac1:GeneScaffold_3477:282506:398813:-1 gene:ENSVPAG00000009943 transcript:ENSVPAT00000009942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHKLIMLVSMVVLHSTFINGKTTCERRLVEEWHTHPLSYVVNWTLTGNICMDFYGDCWF
GDGTTKMNTSGNQVVPQICPLQIQLGDILVISSEPSLRYPDINLMNVSEASFIDCLQNTT
AEDQLLFGCKLNGMHTVNPRWLSVGTHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXICSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFCEKSMEVSQS
CWKGGISQNESSACTGECPEGFLNQNCETDVNECSPIPCQNDTGCTPIPKDVICTCSPIL
TGKLCKLQPHESFPCKTNATSIKYDKDDHCYICTSVCNRNSYWFVRNACSGHLYPCYCGI
ISHDVYQAEGCKHVWKLGFTGCKGEKHEVVTGAHFSLTPNCTECAVRVNQSEATCRICWL
RHEGTREMCVNECSCLMKEDNKRYWHLCIPASLCKMFAENTTGYEETGCQHEAIYEGEFN
KS
Download sequence
Identical sequences ENSVPAP00000009252 ENSVPAP00000009252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]