SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010174 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010174
Domain Number 1 Region: 158-343
Classification Level Classification E-value
Superfamily ALDH-like 1.01e-67
Family ALDH-like 0.000000224
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-26
Family ALDH-like 0.0000109
Further Details:      
 
Domain Number 3 Region: 395-437
Classification Level Classification E-value
Superfamily ALDH-like 0.000000000505
Family ALDH-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010174   Gene: ENSVPAG00000010925   Transcript: ENSVPAT00000010926
Sequence length 443
Comment pep:novel genescaffold:vicPac1:GeneScaffold_3150:117537:236178:1 gene:ENSVPAG00000010925 transcript:ENSVPAT00000010926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDVDKAVEAAQAAFQRGSAWRRLDALSRGRLLHQLADLMERDRAILATLETMDTGKPFLH
AFFIDLEGCIKTLRYFAGWADKIQGRTIPTDDNVCFTRHEPIGVCGAITPXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGVVNIVPGFGPTEGAAISSHPQ
INKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFN
QGQCCTAASRVFVEEQVYGEFVRRSVEYAKKRPVGDPFDVRTEQGPQIDQKQFDKILDLI
ESGKKEGARLECGGSALEDGGLFIKPTVFSEVTDSMRIAKEEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINCYNAIYAQAPFGGFKMSGNGREL
GEYALAEYTEVKTVTIKLDDKNP
Download sequence
Identical sequences ENSVPAP00000010174 ENSVPAP00000010174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]