SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011699 from Vicugna pacos 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011699
Domain Number 1 Region: 432-823
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.16e-100
Family Ankyrin repeat 0.00000000324
Further Details:      
 
Domain Number 2 Region: 36-326
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.68e-75
Family Ankyrin repeat 0.00000118
Further Details:      
 
Domain Number 3 Region: 4063-4173
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-25
Family DEATH domain, DD 0.0049
Further Details:      
 
Domain Number 4 Region: 386-450
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000207
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011699   Gene: ENSVPAG00000012587   Transcript: ENSVPAT00000012587
Sequence length 4335
Comment pep:novel genescaffold:vicPac1:GeneScaffold_3673:1141195:1471457:-1 gene:ENSVPAG00000012587 transcript:ENSVPAT00000012587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAASQLKKNRDLEINTEEEPEKKRKHRKRSRDRKKKSDANASLRAARAGHLEKALEYI
KNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAE
VVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVAL
QQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHI
AAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDG
LTPLHCGARSGHEQVVEMLLDRAAPILSKTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXKVVDKIANPNAKALNGFTPLHIACKKNRIKVMELLLKH
GASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVV
RYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSARE
GHEDVAAFLLDHGASLSITTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGLTAL
HVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTR
QGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVGCHYGNIKIVNFLLQQFAKVNAKTKNGYTPLHQAAQQGHTHIINV
LLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEETMTTTTVIEKHKMNVPETMN
EVLDMSDDEVRKANAPEMLSDGEYISDVEEDAMRDTDYLGPQXXXXXXXXXXXXXXXXXX
XXXXXXXXLRLFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTRELDSDSLRHYSW
AADTLDNVNLVSSPVHSGNLSFMVNARGGSMRGSRHHGTRIIIPPRKCTAPTRITCRLVK
RHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGE
TWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQ
IGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQVPDEIVKKILGNKATFSPIVTVEP
RRRKFHKPITMTIPVPPPSGEGVANGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLT
FIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESS
LRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNF
YAFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKETESDQ
DDEAEKADRRQSFASLALRKRYSYLTEPGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFSSRTSPV
TTAGSLERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVVSPAKSTVEV
ISSAKVSMASSLSSPVKQMPGHAEVALVNGSISPLKYPSSSTLINGCKATATLQEKISTA
TNSVSSVVHAATDTVEKVFPATTAMPFSPLRSYVSSAPSAFQSLRTPSASALYTSLGSSI
SATTSSVTSSIITVPVYSVVNVLPEPALKKLPDSNSLTKSAAALLSPIKTLTTETHPQPH
FNRTSSPVKSSLFLAPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQTDVPEEKP
FQPELPPEGRMDDEEPFKIVEKVKEDLVKVSEILKKDVCVDNKGPPKPKSDTGQSPEDDW
VEFSSEIRERASVYSLSLERVQVKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITTTSCVDVKSRIP
VKNTHRDTTGSVRKPCATHKQEQPEKGKAKQLPSKLPVKVRSTCVTTTTTTTTSTTTTTT
TVKVRKSQLKEVCKHSIEYFKGISGETLKLVDRLSEEDKKMQSELSDEEDSTSRTTSLSE
PSRGGWPSVTTKSARDKKTEAAPLKSKSEKAGSEKRSSRRTGPQSPCERTDIRMAIVADH
LGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTAVLTK
INRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGWQNETSSGDLESPAQARRITG
GLLDRLDDSPDQCRDSITSYLKGEPGKFEANGSHAEVTPEAKTKSYFPEAQNDAGKQSAK
ETLKPKIQGSGRADEAAPSLAAYQKALEETSKFVIEEPKPCVPVSMKKMSRTSPADGKPK
LNLHEEEGSNGSEQK
Download sequence
Identical sequences ENSVPAP00000011699 ENSVPAP00000011699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]