SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000344 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000344
Domain Number 1 Region: 261-344
Classification Level Classification E-value
Superfamily E set domains 2.05e-18
Family E-set domains of sugar-utilizing enzymes 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000344   Gene: ENSPCAG00000000348   Transcript: ENSPCAT00000000369
Sequence length 597
Comment pep:novel genescaffold:proCap1:GeneScaffold_1717:4241:112263:-1 gene:ENSPCAG00000000348 transcript:ENSPCAT00000000369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQENIPRGGTTMKEEPLGSGMNPVRSLHTAGVMDATAAQIGVGLARAQFEKQPPSNL
RKSNFFHFMLTLYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGVRT
EQDLYVRLIDSMTKQXXXXXXXXXXXXXXXXXXXXXXXXXRCCDKKSCGNRNETPSDPVI
IDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGR
RARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVW
SELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRLVYTALNEPTIDYGFQRLQK
VIPRHPGDPERLPTCSGEVLLKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNH
NQIPTLGNTPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ
QSNYNTVSTSMNGYGSGGMANLGVPGSPGFLNGSSANSPYGIVPSSPTMAASSVTLPSNC
SSTHGIFSFSPANVISAVKQKSAFAPVVRPQASPPPSCTSANGNGLQAMSGLVVPPM
Download sequence
Identical sequences ENSPCAP00000000344 ENSPCAP00000000344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]