SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000549 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000549
Domain Number 1 Region: 541-726
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000656
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000000549
Domain Number - Region: 439-526
Classification Level Classification E-value
Superfamily TPR-like 0.0552
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000549   Gene: ENSPCAG00000000563   Transcript: ENSPCAT00000000582
Sequence length 755
Comment pep:novel genescaffold:proCap1:GeneScaffold_984:33391:57432:-1 gene:ENSPCAG00000000563 transcript:ENSPCAT00000000582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMGRTGEGAVSLLERRRL
NQLLLPLLQGPDITLSKLYKLIEDSCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDTDMELANR
EENEGKMEKEELDVSVREEEVSYSGPLSQKQAEVFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSL
RYAALNLAALHCRFGHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
STAQKTAIWRLYGRSTMALQQAQMLLSMNSLESLSAGVQQSNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAVNDGRYHLADSLVAGITALNS
IEGVYRKAVVLQAQNQMSEAHKLLQKLLIHCQKMKNTEMAISILLSVAELYWRSSSPTVA
LPVLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAVLDK
GRAMFLVAKCQVASAASYDPPKRAEALEAAIENLNEARSYFAKVDCKEQIRDVVYFQARL
CHTLGRTQERNRCARLFRHLHQELPSHGVPLVNHL
Download sequence
Identical sequences ENSPCAP00000000549 ENSPCAP00000000549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]