SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000002234 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000002234
Domain Number 1 Region: 111-151,195-273
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000187
Family Transcription factor MalT domain III 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000002234   Gene: ENSPCAG00000002368   Transcript: ENSPCAT00000002374
Sequence length 308
Comment pep:novel scaffold:proCap1:scaffold_14273:17306:25646:1 gene:ENSPCAG00000002368 transcript:ENSPCAT00000002374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAPGPETGGPGEVDELFDVKNAFYIGSYQQCINEAQRVKPSSPERDVERDVFLYRAY
LAQRKYGVVLDEIKPSSAPELQAVRMLAEYLTSEGHRDEVVAHLDREMSRSVDVTNTTFL
LMAASIYLHDGNPDAALRALHQGDSLECSAMVVQILLKLDRLDLARKELKKMQDQDEDAT
LTQLATAWVNLAVGGEKLQDAYYAFQELADKCSSTLLLLNGQAACHMAQGRWEDAEGVLQ
EALDKDSGHPETLINLIVLSQHLGKPPEVTNRYLSQLKDSHRSHPFIKEYQAKENDFDRL
VLQYAPSA
Download sequence
Identical sequences ENSPCAP00000002234 ENSPCAP00000002234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]