SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006161 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006161
Domain Number 1 Region: 568-636,741-807
Classification Level Classification E-value
Superfamily TPR-like 6.07e-24
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000006161
Domain Number - Region: 480-513
Classification Level Classification E-value
Superfamily TPR-like 0.0331
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number - Region: 179-243
Classification Level Classification E-value
Superfamily SIS domain 0.0348
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006161   Gene: ENSPCAG00000006598   Transcript: ENSPCAT00000006588
Sequence length 915
Comment pep:novel genescaffold:proCap1:GeneScaffold_3147:126792:168829:1 gene:ENSPCAG00000006598 transcript:ENSPCAT00000006588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANINLKEVTLIVVVVIACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYLFSELKPMSYHLLNLIFHAVVSVVFLKVCRLFLDSRSS
VIASLLFAVHPVHTEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWAPIALTVFL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCSTAGQFLRGKSSIPFSMLQTLIKLI
VLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPSRQLTFNYLLPVNAWLLLNPSEL
CCDWTMGTIPLIESFLDVRNLATFTFFCFLGALAIFSLRYPGDSSKTVLMALSLMVLPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISNRSVLKKLSWVCLSMVIFTHALK
TLHRNWDWESEYTLFMSALKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDI
GAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGELLLKMNKPLGAKEAYLKALELDRNNADLW
YNLAIVHIELKEPNEALKNFNHALGLNPKHKLALFNSAILMQESXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXPDHIKGLIKGDILMNQKKDIPGAKKCFEKILEMDPSNVQGKHNLCVVY
FEEKDLLKAERCLIETLALAPHEEYIHRHLNIVRDKISSASFIEQPIFPTGEASGIKERD
KIPTENMKEVRSEPKPTQIVKASNDDRQSKANKQLGKDTDKETPHKTTKEIKDIEKKRVA
ALKRLEEIERILNGE
Download sequence
Identical sequences ENSPCAP00000006161 ENSPCAP00000006161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]