SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006249 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006249
Domain Number 1 Region: 503-602
Classification Level Classification E-value
Superfamily TPR-like 0.00000886
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006249   Gene: ENSPCAG00000006636   Transcript: ENSPCAT00000006685
Sequence length 776
Comment pep:novel genescaffold:proCap1:GeneScaffold_3090:11044:28715:1 gene:ENSPCAG00000006636 transcript:ENSPCAT00000006685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQLHQLQQIKWRXXXXXXXXXXXXXXXXXXXXXXXXXLDVDSEAKKLLGLGQKHLVMGD
IPAAVNAFEAASLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHVEEEE
GEKTEDESLVENNDNIDEEAREELREQVYDAMGEKEAANKTKEKSLVKPETDKEEETQTE
KGGREELVLSEPAEELQAKVESTPDELTETAGKAKAAGPAAPGLNEAEVTSEKPEQEAPD
TEGGKSVSGVDIQEEEYREKGDQEKQGDVIVSMEEKPKEVSEEQYAVTLDDQGTAVELET
EPGDPSVKAEDLGGEEPKEQVAASENKPGKEQFVGQEVPFAEESPEMKTEAGSEISVKPG
QEAKIPPKDDAVNGLSVARDQTPVEPQPSAEGPAEMKDGSGVEKVRAELVPSQVETKRSI
EESEAAGDGVETKIAQGAAEKSPEDKVKIAANEERQEREEQMKEGEXXXXXXEEDKEDKA
EEMLNDSFFENKSLQENEEEEIGNLELAWDMLDLAKIIFKRQETKEAQLYAAQAHLKLGE
VSVESENYMQAVEEQASLNLQEQYLEAHDRLLAETHYQLGLAYGYNTQYDEAVAQFSKSV
EVIEKRMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKESQRSGNVAELALK
ATLVESSTSGFTSSGGGSSVSMIASRKPTDGASSSNYVTDISHLVRKKRKPEEESPRKDD
AKKAKQEPEVNGGSGDAVPSGNEVSETMEEGENTTENRPAVEGTVEAGATVEGTAC
Download sequence
Identical sequences ENSPCAP00000006249 ENSPCAP00000006249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]