SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008676 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008676
Domain Number 1 Region: 208-336
Classification Level Classification E-value
Superfamily TPR-like 7.4e-27
Family Tetratricopeptide repeat (TPR) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008676   Gene: ENSPCAG00000009333   Transcript: ENSPCAT00000009296
Sequence length 346
Comment pep:novel genescaffold:proCap1:GeneScaffold_7506:29462:30860:-1 gene:ENSPCAG00000009333 transcript:ENSPCAT00000009296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMLLGSPKGEKDISESQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKCLESMCQEEAELQLPGHS
GTVRLTLASFTQGRDSWLESSEKEALAREERAQGTELFRAGNPEGAARCYGRALRLLLTL
PPPGPQERTTLHANLAACQLLLGQPHLAVQSCDRVLEREPGHLKALYRRGVAQAALGNLE
KATDDLKKVLALDPKNRAAQEELGKVVIQGKKQDAGLAQGLRKMFA
Download sequence
Identical sequences ENSPCAP00000008676 ENSPCAP00000008676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]