SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009885 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009885
Domain Number 1 Region: 560-669
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-19
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 2 Region: 370-445
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-16
Family DBL homology domain (DH-domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 858-917
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000106
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009885   Gene: ENSPCAG00000010534   Transcript: ENSPCAT00000010596
Sequence length 957
Comment pep:novel genescaffold:proCap1:GeneScaffold_1369:3966:35183:-1 gene:ENSPCAG00000010534 transcript:ENSPCAT00000010596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGHRALGGAGPSEPEHPASNHPGAALLACADSYLGVSEPGPPVPRGSASALSGPLDFQL
AGPSDASSGAAPGSRVLPCGASPQHHPTLRFSYHLEGLQPRPGLHQGNRILVKSLXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPKPSYLQMPRILPPSEPI
PPPPSRPLPADPRVVKGLTPRVEAGLSSAAVSSLIEKFEREPVIVTSDRPAPGPSPGPTE
SAMLPPQPLQPPVLPLPEGEASRCLFLLAPGPRDGEKVPNRDSGIDSISSPSNSEETCFV
SDDGPASHSLCPGPPALASMPVALADPHRPASQELDSDLDEDEEEDEEKDRDISVSPMER
QESVELTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLLEEARNRSSFPADVVHGIF
SNICSIYCFHQQFLLPELEKRMEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXSLELIATAAEHSNAAIRKMERMHKLLKVYELLGGEEDIVSPTKELIKEGHILKLSA
KNGTTQDRYLILFNDRLLYCVPRLRLLGQKFSVRARIDVDGMELKESSNFNLPRTFLVSG
KQRSLELQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXDVKAQRSLPLIGFEVGPPEAGERPDRRHVFKITQSHLSWYFS
PETEELQRRWMAVLGRAGRGDTLCLGPTLSEDSEMEEAPVADSGATAEPLEAPQTKT
Download sequence
Identical sequences ENSPCAP00000009885 ENSPCAP00000009885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]