SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011290 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011290
Domain Number 1 Region: 253-309
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000526
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011290   Gene: ENSPCAG00000012130   Transcript: ENSPCAT00000012089
Sequence length 310
Comment pep:novel genescaffold:proCap1:GeneScaffold_3167:730:34544:1 gene:ENSPCAG00000012130 transcript:ENSPCAT00000012089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGPRAPQRSALGRARAGGHRRQVAGGGGRRRAARGGGGSEGRKEAKSEEEEEKEEEKRAV
SGSGEENGSAGRPTAVGCHGCSEACRARGRHPPLLNPGGRGGGGARAGRLGXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXCLLQAELVNYERVKEYCLKVLKKEGENFKALYRSGVAFYHLGDYDKALYY
LKEAKTRQPT
Download sequence
Identical sequences ENSPCAP00000011290 ENSPCAP00000011290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]