SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011344 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011344
Domain Number 1 Region: 487-571,661-800
Classification Level Classification E-value
Superfamily TPR-like 1.23e-17
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000011344
Domain Number - Region: 30-142
Classification Level Classification E-value
Superfamily TPR-like 0.0675
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011344   Gene: ENSPCAG00000012095   Transcript: ENSPCAT00000012150
Sequence length 811
Comment pep:novel genescaffold:proCap1:GeneScaffold_570:7:130798:1 gene:ENSPCAG00000012095 transcript:ENSPCAT00000012150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFGKLLLAEALLEQCLKENHTNVKDSIPLLEKNEPRMTEAKNFLSSILTHGKLSPQFLCE
AMLVLGKLHYLEGSYRDAISMYARAGIDDMSVENKPLYQMRLLSEAFVIKGLSLERLPNS
IASSHRLTEREEEVITCFKRASWIAQVFLQELENSTNNTTSRHLKGSQPADYELTYFLEA
ALQSAYVTNLKKGNIVKGMRDLRELLRAVETKATQNLKVMAAKHLAGVLLHSLSEECYWS
PLSQPLPEFMSKEENAFITQALRKPHLYEGDNLYCPKDNIEEALLLLLISESMXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXSAYAVSLLRECMKLRPSDPTVPLMAAKVCIGSLHWLEEAEHFAMMVIDLGEDA
GEFLPKAYLALGLTYSLQATDATLKSKQDELHRKALQTLEXXXXXXXXXXXXXXXXXXXX
XXXXXISSAMEQLQEVLKLCRDDANALHLLALLFSAQKHYQHALDVINMAITEYPENFNL
MFTKVKLEQVLKGPEEALVTCRHMLRLWQTLYSFSQLGXXXXXXXXXXXXXXXXXXXXXX
XXGLEKDSSFCEGLTLKKQSGMHLTLPDAHEVDSGSRRASSIAASRLEEAMSELSMPSLV
LKQGPMQLWTTLEQIWLQAAELFMEQRHLQEAGFCIQEAAGLFPTSHSVLHMRGRLAEVK
GRAQEAEQLYKEALTVNPDGVHIMHSLGLMLNGLGRKSLAQKVLRDAKRQSTCHEAWGLG
EVLQPQSEAADCFLTALELEASSPVLPFSII
Download sequence
Identical sequences ENSPCAP00000011344 ENSPCAP00000011344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]